PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015882038.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 544aa    MW: 60559.8 Da    PI: 4.7778
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015882038.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS366.73.1e-1121635351374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetsekn....sseelaalklfsevsPi 90 
                     lv+ Ll+cAeav  +d++la++lL+++   ++p gd++qR+  +f+ +L++rl+  +  ++  +++  +t+        +e++ a++l+++++P+
  XP_015882038.1 163 LVHMLLACAEAVGCRDTQLADSLLSQIWASVNPWGDSLQRVSYCFAAGLKSRLSLlHNVKTNGTFTNGATD--IslvtREEKMEAFQLLYQTTPY 255
                     689**************************************************983333444444433333..13466889999*********** PP

            GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak 184
                     l f++++aN+aI +a+ g++ +HiiD+++++ lQWp+Ll++LasRp+gpp +lRiTg+++ +++s  ele+  + L k A++lg+++efnvl++ 
  XP_015882038.1 256 LAFGFMVANEAICQAAVGKDNLHIIDLGMEHTLQWPSLLRTLASRPKGPPkKLRITGLVD-DHQSLLELESSMKSLVKEASSLGIQLEFNVLTEA 349
                     **********************************************888879********.77899*************************9666 PP

            GRAS 185 .rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                      + + l+ e+L++++gEal++n +++lh+ ++es  + +   ++L+++k+lsP+++++veq+a+hn++ Fl rfle+l+yysa+fdslea+lpr+
  XP_015882038.1 350 vTPSLLTKENLNLREGEALVINGIMHLHKYVKESRGSLK---AILQALKKLSPTLLTLVEQDANHNGPFFLGRFLESLHYYSAIFDSLEASLPRN 441
                     599999*************************88776666...9**************************************************** PP

            GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                     s +r+k+Er  +++ei+n+va eg++r+erhe++ +Wr++l++aGF+ + l+   ++qa+++l+ ++ dgy++ +e+g+l+lgWk rp++ +SaW
  XP_015882038.1 442 SPQRMKIERLHFAEEIRNIVAFEGSNRIERHERADQWRRQLGRAGFQVMGLK--CMSQARMMLSVYGCDGYTLGSEKGCLLLGWKARPIMLASAW 534
                     ************************************************9985..89*************************************** PP

            GRAS 374 r 374
                     +
  XP_015882038.1 535 Q 535
                     6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.49137517IPR005202Transcription factor GRAS
PfamPF035141.1E-109163535IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MESFNVGWLS FPIHESFNHD LAIRRFCPAR VEQEQGGGGE WEEILNEIDE LCLPSDTTGI  60
SPCLAASEVD EFVDSIINMD HYEKDDYINN SLAENQSNLD CFHDEMEMFS MENDVYGSDV  120
LTMIEGDEME SAISGSAEDF GGAPDMVPRV AEVSHGVDQG LHLVHMLLAC AEAVGCRDTQ  180
LADSLLSQIW ASVNPWGDSL QRVSYCFAAG LKSRLSLLHN VKTNGTFTNG ATDISLVTRE  240
EKMEAFQLLY QTTPYLAFGF MVANEAICQA AVGKDNLHII DLGMEHTLQW PSLLRTLASR  300
PKGPPKKLRI TGLVDDHQSL LELESSMKSL VKEASSLGIQ LEFNVLTEAV TPSLLTKENL  360
NLREGEALVI NGIMHLHKYV KESRGSLKAI LQALKKLSPT LLTLVEQDAN HNGPFFLGRF  420
LESLHYYSAI FDSLEASLPR NSPQRMKIER LHFAEEIRNI VAFEGSNRIE RHERADQWRR  480
QLGRAGFQVM GLKCMSQARM MLSVYGCDGY TLGSEKGCLL LGWKARPIML ASAWQVNNVS  540
SSSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-491635354375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015882038.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM5WH380.0M5WH38_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s09790.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132512730
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.12e-79RGA-like 1